CABS-dock: 54c38ecc34a865e

Project name: 54c38ecc34a865e

Status: done

submitted: 2026-07-09 04:56:52, status changed: 2026-07-09 09:03:11

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	SKLAKSSPRGFVV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	44.6013	2.39903	33.6938	107
cluster_2.pdb ( medoid)	24.486	5.18663	12.0432	127
cluster_3.pdb ( medoid)	17.4476	4.06934	14.784	71
cluster_4.pdb ( medoid)	16.5959	8.73708	42.8043	145
cluster_5.pdb ( medoid)	15.0681	6.76928	29.4449	102
cluster_6.pdb ( medoid)	12.3063	7.8009	36.8498	96
cluster_7.pdb ( medoid)	12.073	11.8447	38.2039	143
cluster_8.pdb ( medoid)	8.82073	9.52302	23.7958	84
cluster_9.pdb ( medoid)	5.6307	12.9646	26.0235	73
cluster_10.pdb ( medoid)	3.23604	16.069	36.7825	52