Project name: 9ASF_YTAVSS_E2

Status: done

submitted: 2026-05-30 16:27:50, status changed: 2026-05-31 09:55:04

Project settings
Protein sequence(s) GSSHSMRYFFTSVSRPGRGEPRFIAVVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSSQQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW input pdb
Peptide sequence YTAVSSTWHWTGHNVKH
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCEEECCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 64.2087 1.65087 17.8285 106
cluster_2.pdb ( medoid) 38.5879 2.79881 16.3451 108
cluster_3.pdb ( medoid) 29.3889 3.30056 6.53339 97
cluster_4.pdb ( medoid) 23.9667 4.67315 15.7936 112
cluster_5.pdb ( medoid) 16.9153 9.16332 49.5521 155
cluster_6.pdb ( medoid) 14.1947 11.2014 54.1394 159
cluster_7.pdb ( medoid) 10.9018 6.97135 19.6612 76
cluster_8.pdb ( medoid) 10.1676 9.44172 24.5258 96
cluster_9.pdb ( medoid) 6.64123 10.3896 53.5573 69
cluster_10.pdb ( medoid) 2.19264 10.0336 28.6641 22