CABS-dock: 55572e0061f3c64

Project name: 55572e0061f3c64

Status: done

submitted: 2026-01-19 14:30:18, status changed: 2026-01-20 00:54:38

Project settings

Protein sequence(s)	GQTLPRCPEKCGNVTLEYPFGFSPGCWRAEDPSFNLSCVNENLFYKGLEVVEISHSSQLRVLYPASYICYNSKGKFAKGTYYWSNLGNLTLSGNNTITALGCNSYAFVSSNGTRRNSVGCISACDALSHEANGECNGEGCCQNPVPAGNNWLIVRSYRFDNDTSVQPISEGQCIYAFLVENGKFKYNASDKYSYLQNRNVGFPVVLDWSIRGETCGQVGEKKCGVNGICSNSASGIGYTCKCKGGFQGNPYLQNGCQDINECTTANPIHKHNCSGDSTCENKLGHFRCNCRSRYELNTTTNTCKPKGN input pdb
Peptide sequence	GENQKPMFELAEGATLKNVNLGENE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCEEECCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.9955	4.53645	16.6678	127
cluster_2.pdb ( medoid)	25.5332	5.28724	31.222	135
cluster_3.pdb ( medoid)	19.7631	6.52731	24.6014	129
cluster_4.pdb ( medoid)	15.6218	6.59337	19.2194	103
cluster_5.pdb ( medoid)	10.8505	13.4556	40.0157	146
cluster_6.pdb ( medoid)	7.98573	9.6422	58.8075	77
cluster_7.pdb ( medoid)	7.57281	8.18718	32.2071	62
cluster_8.pdb ( medoid)	6.19043	15.6694	46.476	97
cluster_9.pdb ( medoid)	4.25173	23.5198	58.1615	100
cluster_10.pdb ( medoid)	1.54804	15.5035	45.034	24