CABS-dock: 556d8be9dd008ac

Project name: 556d8be9dd008ac

Status: done

submitted: 2025-04-14 06:17:48, status changed: 2025-04-14 11:18:26

Project settings

Protein sequence(s)	GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGIYAVGGSGCINSVERYEPERDEWLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKRRSALGITVQGRIYVLGGYDGTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT input pdb
Peptide sequence	SAPSGADRPSAR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.2834	4.7939	17.4395	126
cluster_2.pdb ( medoid)	13.1191	13.9491	46.95	183
cluster_3.pdb ( medoid)	12.5469	13.6288	40.4788	171
cluster_4.pdb ( medoid)	10.4932	15.5339	45.7458	163
cluster_5.pdb ( medoid)	10.2761	7.68775	27.5741	79
cluster_6.pdb ( medoid)	8.264	6.41336	23.4075	53
cluster_7.pdb ( medoid)	6.85313	11.9653	32.9608	82
cluster_8.pdb ( medoid)	5.73153	9.42157	30.7351	54
cluster_9.pdb ( medoid)	3.6371	9.62305	30.6851	35
cluster_10.pdb ( medoid)	3.54085	15.2506	32.1735	54