CABS-dock: 5594ad95222e2c9

Project name: 5594ad95222e2c9

Status: done

submitted: 2026-06-18 00:12:06, status changed: 2026-06-18 08:22:41

Project settings

Protein sequence(s)	ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGY input pdb
Peptide sequence	FDETVT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	38.0566	3.23203	22.7787	123
cluster_2.pdb ( medoid)	36.5142	5.88813	17.7676	215
cluster_3.pdb ( medoid)	33.0801	4.77629	23.3968	158
cluster_4.pdb ( medoid)	18.3196	4.74902	15.2063	87
cluster_5.pdb ( medoid)	17.046	3.22656	7.31493	55
cluster_6.pdb ( medoid)	14.2149	8.5122	31.5519	121
cluster_7.pdb ( medoid)	11.3441	8.46252	30.2334	96
cluster_8.pdb ( medoid)	10.2894	9.23279	34.446	95
cluster_9.pdb ( medoid)	2.95202	8.46878	19.4429	25
cluster_10.pdb ( medoid)	2.08831	11.9714	36.7841	25