Project name: Yeiner Miguel

Status: done

submitted: 2026-04-19 14:01:27, status changed: 2026-04-19 22:19:46

Project settings
Protein sequence(s) GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR input pdb
Peptide sequence KLDRLDQEF
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 169.294 0.602503 15.3093 102
cluster_2.pdb ( medoid) 30.105 5.58046 24.438 168
cluster_3.pdb ( medoid) 28.0187 4.31854 13.935 121
cluster_4.pdb ( medoid) 19.8966 6.08144 28.1883 121
cluster_5.pdb ( medoid) 16.3653 5.80496 14.7715 95
cluster_6.pdb ( medoid) 16.1374 4.0279 21.2216 65
cluster_7.pdb ( medoid) 14.4142 6.9376 32.7748 100
cluster_8.pdb ( medoid) 12.6041 8.17196 30.5597 103
cluster_9.pdb ( medoid) 8.87244 3.71938 19.1921 33
cluster_10.pdb ( medoid) 7.11351 12.9331 38.4916 92