CABS-dock: 56c7c2a8d6f4d77

Project name: 56c7c2a8d6f4d77

Status: done

submitted: 2026-07-16 14:02:32, status changed: 2026-07-16 19:46:53

Project settings

Protein sequence(s)	PYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPE input pdb
Peptide sequence	TPIMSMPPLLK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.7666	8.08202	20.8062	184
cluster_2.pdb ( medoid)	21.5313	5.57329	20.1576	120
cluster_3.pdb ( medoid)	19.1903	9.64027	44.2617	185
cluster_4.pdb ( medoid)	18.7412	5.86943	26.8828	110
cluster_5.pdb ( medoid)	12.0002	5.91658	35.5721	71
cluster_6.pdb ( medoid)	9.60217	7.81073	17.8417	75
cluster_7.pdb ( medoid)	8.32719	11.7687	34.7788	98
cluster_8.pdb ( medoid)	7.7912	8.59944	36.5898	67
cluster_9.pdb ( medoid)	4.83298	11.3801	25.3993	55
cluster_10.pdb ( medoid)	2.64549	13.2301	30.5097	35