Project name: 56c7c2a8d6f4d77

Status: done

submitted: 2026-07-16 14:02:32, status changed: 2026-07-16 19:46:53

Project settings
Protein sequence(s) PYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPE input pdb
Peptide sequence TPIMSMPPLLK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.7666 8.08202 20.8062 184
cluster_2.pdb ( medoid) 21.5313 5.57329 20.1576 120
cluster_3.pdb ( medoid) 19.1903 9.64027 44.2617 185
cluster_4.pdb ( medoid) 18.7412 5.86943 26.8828 110
cluster_5.pdb ( medoid) 12.0002 5.91658 35.5721 71
cluster_6.pdb ( medoid) 9.60217 7.81073 17.8417 75
cluster_7.pdb ( medoid) 8.32719 11.7687 34.7788 98
cluster_8.pdb ( medoid) 7.7912 8.59944 36.5898 67
cluster_9.pdb ( medoid) 4.83298 11.3801 25.3993 55
cluster_10.pdb ( medoid) 2.64549 13.2301 30.5097 35