Project name: GGA3_VHS-6

Status: done

submitted: 2026-07-09 12:01:35, status changed: 2026-07-09 14:26:24

Project settings
Protein sequence(s) ESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLI input pdb
Peptide sequence FTAPYPR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.8534 6.41744 27.3583 198
cluster_2.pdb ( medoid) 29.6242 3.91572 11.1018 116
cluster_3.pdb ( medoid) 26.5841 5.60484 16.3793 149
cluster_4.pdb ( medoid) 17.2541 2.60808 4.90942 45
cluster_5.pdb ( medoid) 15.077 6.76528 31.4561 102
cluster_6.pdb ( medoid) 12.4411 3.4563 10.6486 43
cluster_7.pdb ( medoid) 9.54392 6.07716 13.6423 58
cluster_8.pdb ( medoid) 8.70703 11.7147 25.0549 102
cluster_9.pdb ( medoid) 8.39754 10.8365 28.7351 91
cluster_10.pdb ( medoid) 6.576 14.5985 32.0004 96