CABS-dock: ajcabs05w10

Project name: ajcabs05w10

Status: done

submitted: 2026-07-08 09:13:58, status changed: 2026-07-08 10:19:01

Project settings

Protein sequence(s)

REYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPIN input pdb

Peptide sequence

CSTRTRTVC

Simulation mc cycles

Peptide secondary structure psipred

CCCCCEECC

Contact information

1:PEP 9:PEP 5.5 10.0

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	114.875	0.609359	6.23908	70
cluster_2.pdb ( medoid)	57.6765	3.71035	14.44	214
cluster_3.pdb ( medoid)	21.0145	8.04206	31.2255	169
cluster_4.pdb ( medoid)	13.805	13.6182	32.1154	188
cluster_5.pdb ( medoid)	11.3136	5.03818	14.9373	57
cluster_6.pdb ( medoid)	7.99815	11.6277	30.2307	93
cluster_7.pdb ( medoid)	6.71334	9.23534	24.2047	62
cluster_8.pdb ( medoid)	5.89494	10.5175	27.7307	62
cluster_9.pdb ( medoid)	5.44212	10.2901	19.5548	56
cluster_10.pdb ( medoid)	2.01286	14.4073	31.6807	29