Project name: ajcabs05w10

Status: done

submitted: 2026-07-08 09:13:58, status changed: 2026-07-08 10:19:01

Project settings
Protein sequence(s) REYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPIN input pdb
Peptide sequence CSTRTRTVC
Simulation mc cycles50
Peptide secondary structure psipred CCCCCEECC
Contact information
1:PEP 9:PEP 5.5 10.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 114.875 0.609359 6.23908 70
cluster_2.pdb ( medoid) 57.6765 3.71035 14.44 214
cluster_3.pdb ( medoid) 21.0145 8.04206 31.2255 169
cluster_4.pdb ( medoid) 13.805 13.6182 32.1154 188
cluster_5.pdb ( medoid) 11.3136 5.03818 14.9373 57
cluster_6.pdb ( medoid) 7.99815 11.6277 30.2307 93
cluster_7.pdb ( medoid) 6.71334 9.23534 24.2047 62
cluster_8.pdb ( medoid) 5.89494 10.5175 27.7307 62
cluster_9.pdb ( medoid) 5.44212 10.2901 19.5548 56
cluster_10.pdb ( medoid) 2.01286 14.4073 31.6807 29