CABS-dock: 57f2f67b1533d36

Project name: 57f2f67b1533d36

Status: done

submitted: 2025-08-25 04:27:40, status changed: 2025-08-25 07:42:03

Project settings

Protein sequence(s)	SGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTIKP input pdb
Peptide sequence	NDIEYNAPSEDKNHGARQLY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.5044	7.63932	33.2706	149
cluster_2.pdb ( medoid)	18.5835	8.01788	27.9678	149
cluster_3.pdb ( medoid)	15.6274	5.37517	18.107	84
cluster_4.pdb ( medoid)	13.2284	9.97852	28.4272	132
cluster_5.pdb ( medoid)	12.9455	11.4325	32.5818	148
cluster_6.pdb ( medoid)	8.19576	10.7373	19.7372	88
cluster_7.pdb ( medoid)	6.74946	10.5194	27.8368	71
cluster_8.pdb ( medoid)	6.36368	6.7571	20.7806	43
cluster_9.pdb ( medoid)	6.02428	12.2836	28.6903	74
cluster_10.pdb ( medoid)	4.27249	14.5115	36.3156	62