CABS-dock: 580194f2715d475

Project name: 580194f2715d475

Status: done

submitted: 2026-03-18 04:46:56, status changed: 2026-03-18 12:53:50

Project settings

Protein sequence(s)	MALPENLTREQCLYLAKLAEQAERYEEMVKFMDKLVIGSGSSELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNDEHVVLVKDYRSKVESELSDVCAGILKILDQYLIPSASAGESKVFYLKMKGDYYRYLAEFKVGNERKEAAEDTMLAYKAAQDIAVAELAPTHPIRLGLALNFSVFYYEILNASEKACSMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDEA input pdb
Peptide sequence	KSWSSDKAD
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	51.1549	2.16988	6.10979	111
cluster_2.pdb ( medoid)	45.6722	4.13819	13.4223	189
cluster_3.pdb ( medoid)	42.9636	4.72493	33.8269	203
cluster_4.pdb ( medoid)	38.0425	2.23434	13.6091	85
cluster_5.pdb ( medoid)	20.935	4.10794	22.749	86
cluster_6.pdb ( medoid)	20.3215	4.87169	12.8652	99
cluster_7.pdb ( medoid)	7.13648	7.42663	25.2891	53
cluster_8.pdb ( medoid)	5.8749	13.7875	31.5065	81
cluster_9.pdb ( medoid)	5.50739	9.805	26.1187	54
cluster_10.pdb ( medoid)	3.40177	11.4646	30.7763	39