Project name: K1_USP7

Status: done

submitted: 2026-01-12 16:55:39, status changed: 2026-01-12 21:57:56

Project settings
Protein sequence(s) TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW input pdb
Peptide sequence PSSRSNTLPRSNTSSGASPPADASDSDAKS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.9103 5.20303 36.7732 114
cluster_2.pdb ( medoid) 18.2202 7.84844 28.9998 143
cluster_3.pdb ( medoid) 17.5991 5.79576 27.5851 102
cluster_4.pdb ( medoid) 14.8893 8.79828 27.7676 131
cluster_5.pdb ( medoid) 10.7213 5.03669 11.5837 54
cluster_6.pdb ( medoid) 9.8342 16.4731 37.2442 162
cluster_7.pdb ( medoid) 9.68989 5.67602 21.8587 55
cluster_8.pdb ( medoid) 9.44237 11.4378 39.4558 108
cluster_9.pdb ( medoid) 5.53843 14.0834 38.9834 78
cluster_10.pdb ( medoid) 5.4126 9.79196 26.1731 53