Project name: JSLEE_28

Status: done

submitted: 2023-11-29 07:28:40, status changed: 2023-11-29 09:36:00

Project settings
Protein sequence(s) SRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGG input pdb
Peptide sequence ENNVLSPLPSQAMDDLMLSPDDIEQWFTED
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Flexible regions
100:A - 92:A
Unlikely to bind regions
119:A - 119:A 114:A - 118:A 158:A - 181:A
Contact information
146:A 19:PEP 10.0 1.0
126:A 26:PEP 3.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.2333 3.96574 8.0444 108
cluster_2.pdb ( medoid) 24.2266 11.4337 28.7934 277
cluster_3.pdb ( medoid) 20.5937 6.84675 21.5896 141
cluster_4.pdb ( medoid) 11.8471 10.2979 27.777 122
cluster_5.pdb ( medoid) 11.7515 5.02063 9.99171 59
cluster_6.pdb ( medoid) 11.3444 8.37417 19.2973 95
cluster_7.pdb ( medoid) 9.17824 8.49836 20.7341 78
cluster_8.pdb ( medoid) 5.15342 8.92611 21.3818 46
cluster_9.pdb ( medoid) 3.52586 9.07579 27.5451 32
cluster_10.pdb ( medoid) 3.52041 11.9304 24.9341 42