Project name: 5978645b836dd86

Status: done

submitted: 2026-01-22 13:26:30, status changed: 2026-01-22 15:14:33

Project settings
Protein sequence(s) GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence AAREEVPGRRGYPGY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.9402 8.78691 20.9824 184
cluster_2.pdb ( medoid) 19.6516 5.75017 19.852 113
cluster_3.pdb ( medoid) 18.8259 7.91462 29.1162 149
cluster_4.pdb ( medoid) 16.0918 10.1294 25.2479 163
cluster_5.pdb ( medoid) 15.4623 5.62659 17.8666 87
cluster_6.pdb ( medoid) 11.0118 9.08113 20.6852 100
cluster_7.pdb ( medoid) 10.4236 7.57895 24.5766 79
cluster_8.pdb ( medoid) 4.43776 10.3656 23.3836 46
cluster_9.pdb ( medoid) 4.22553 10.4129 25.1243 44
cluster_10.pdb ( medoid) 3.38395 10.3429 24.5401 35