Project name: 599d90ede31a047

Status: done

submitted: 2026-01-20 05:54:30, status changed: 2026-01-20 08:57:26

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPANPVTGRPLVNIYNCSGVQVGDNNYLTMQQTMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence RVIFVQVGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.7672 8.6433 38.0043 240
cluster_2.pdb ( medoid) 16.7491 6.08987 18.1205 102
cluster_3.pdb ( medoid) 15.2865 10.1397 40.9995 155
cluster_4.pdb ( medoid) 15.2148 7.62414 21.2352 116
cluster_5.pdb ( medoid) 13.9864 8.72278 32.6469 122
cluster_6.pdb ( medoid) 5.40416 14.9885 37.2969 81
cluster_7.pdb ( medoid) 4.28473 13.3031 27.8441 57
cluster_8.pdb ( medoid) 3.25983 14.7247 33.8251 48
cluster_9.pdb ( medoid) 3.08119 14.6048 36.8017 45
cluster_10.pdb ( medoid) 1.82718 18.6079 41.2878 34