Project name: FSSIFSFLAF-6T7Z

Status: done

submitted: 2025-04-22 01:54:10, status changed: 2025-04-22 06:43:28

Project settings
Protein sequence(s) RLIYTAGGYFRQSLSYLEAYNPSDGTWLRRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVATATWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT input pdb
Peptide sequence FSSIFSFLAF
Simulation mc cycles50
Peptide secondary structure psipred CCCHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.6759 4.56159 26.8176 108
cluster_2.pdb ( medoid) 14.9722 2.60482 11.3444 39
cluster_3.pdb ( medoid) 12.5777 8.03009 30.1757 101
cluster_4.pdb ( medoid) 11.9203 12.7514 30.4709 152
cluster_5.pdb ( medoid) 11.4606 15.4442 36.5298 177
cluster_6.pdb ( medoid) 11.3075 10.7893 36.3245 122
cluster_7.pdb ( medoid) 10.1519 5.91021 22.3222 60
cluster_8.pdb ( medoid) 9.58871 13.6619 37.0763 131
cluster_9.pdb ( medoid) 8.46311 9.80727 23.4898 83
cluster_10.pdb ( medoid) 6.94855 3.8857 22.3671 27