CABS-dock: 5a20be7c6048e80

Project name: 5a20be7c6048e80

Status: done

submitted: 2026-07-08 10:27:32, status changed: 2026-07-08 14:28:13

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	VQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.7803	4.84255	30.579	120
cluster_2.pdb ( medoid)	17.2254	9.81111	40.1232	169
cluster_3.pdb ( medoid)	14.672	10.8369	45.08	159
cluster_4.pdb ( medoid)	7.39854	12.9755	29.8357	96
cluster_5.pdb ( medoid)	6.85371	13.4234	37.0648	92
cluster_6.pdb ( medoid)	5.48392	15.1352	32.8256	83
cluster_7.pdb ( medoid)	4.84769	15.4713	40.1105	75
cluster_8.pdb ( medoid)	4.33149	19.162	47.4762	83
cluster_9.pdb ( medoid)	3.96063	15.1491	33.8247	60
cluster_10.pdb ( medoid)	3.2717	19.2561	43.3613	63