CABS-dock: PruebaTestNico

Project name: PruebaTestNico

Status: done

submitted: 2026-06-17 20:44:37, status changed: 2026-06-18 02:04:50

Project settings

Protein sequence(s)	GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTAFFAQLQLDEETGEFL input pdb
Peptide sequence	DEQIPSHPPR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.22	5.29716	35.3529	123
cluster_2.pdb ( medoid)	17.4402	6.70862	37.2091	117
cluster_3.pdb ( medoid)	16.0526	5.79346	31.4736	93
cluster_4.pdb ( medoid)	12.3314	8.27158	28.8344	102
cluster_5.pdb ( medoid)	12.3168	7.87545	27.049	97
cluster_6.pdb ( medoid)	8.85751	12.3059	44.0663	109
cluster_7.pdb ( medoid)	8.13511	14.1363	44.6518	115
cluster_8.pdb ( medoid)	5.9276	14.8458	41.6847	88
cluster_9.pdb ( medoid)	5.26501	14.4349	37.928	76
cluster_10.pdb ( medoid)	4.7621	16.7993	41.9256	80