CABS-dock: JG14912.T1

Project name: JG14912.T1_1+P0DTD2

Status: done

submitted: 2026-02-27 10:56:24, status changed: 2026-02-27 16:24:19

Project settings

Protein sequence(s)	MDPKISEMHPALRLVDPQIQQLAVTRMNNVGPKVVYPIILRLGSPLSSLNMARKTLNSLEDKAFQLTPIAVVQMTKLATTEELPDEFVVVTVKISEMHPALRLVDPQIQLAVTPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK input pdb
Peptide sequence	RETLVRKVVLQKRVKSRYSWSK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHHHHHHHHHHCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.4602	7.21276	22.7196	162
cluster_2.pdb ( medoid)	18.4783	4.16706	21.7921	77
cluster_3.pdb ( medoid)	15.7872	8.55123	25.0695	135
cluster_4.pdb ( medoid)	12.1084	8.83685	32.7662	107
cluster_5.pdb ( medoid)	10.1341	12.9266	30.3791	131
cluster_6.pdb ( medoid)	10.0215	11.9742	22.849	120
cluster_7.pdb ( medoid)	8.13408	12.7857	28.075	104
cluster_8.pdb ( medoid)	6.16978	11.3456	23.7324	70
cluster_9.pdb ( medoid)	6.01841	9.13863	27.3677	55
cluster_10.pdb ( medoid)	2.71074	14.3872	24.4167	39