CABS-dock: DENOVO1

Project name: DENOVO1

Status: done

submitted: 2026-01-20 02:05:59, status changed: 2026-01-20 06:15:11

Project settings

Protein sequence(s)	EPKFTKCRSPERETFSCHWTDEVHGPIQLFYTRRNEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPEPKFTKCRSPERETFSCHWTDEVHGPIQLFYTRRNQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQM input pdb
Peptide sequence	LSFDWQPLEARNIEF
Simulation mc cycles	10
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.8155	5.70129	26.6818	227
cluster_2.pdb ( medoid)	20.7591	4.91351	13.9748	102
cluster_3.pdb ( medoid)	13.2885	9.10564	32.8727	121
cluster_4.pdb ( medoid)	11.2007	8.92802	15.6023	100
cluster_5.pdb ( medoid)	10.8927	7.89522	21.9273	86
cluster_6.pdb ( medoid)	5.79988	13.621	42.9445	79
cluster_7.pdb ( medoid)	5.05225	14.2511	25.1754	72
cluster_8.pdb ( medoid)	4.54567	8.79958	23.0408	40
cluster_9.pdb ( medoid)	3.68673	12.7484	34.8668	47
cluster_10.pdb ( medoid)	1.79308	14.5002	33.566	26