CABS-dock: 5ad8357031470c3

Project name: 5ad8357031470c3

Status: done

submitted: 2026-07-16 07:23:10, status changed: 2026-07-16 09:28:48

Project settings

Protein sequence(s)	SMTDCEFGYIYRLAQDYLQCVLQIPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFE input pdb
Peptide sequence	LFLIKLLK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	59.732	2.91301	13.4379	174
cluster_2.pdb ( medoid)	55.2494	2.60636	12.6116	144
cluster_3.pdb ( medoid)	44.1336	1.83534	6.16504	81
cluster_4.pdb ( medoid)	40.995	3.63459	15.8309	149
cluster_5.pdb ( medoid)	31.1293	3.82277	20.7369	119
cluster_6.pdb ( medoid)	14.7299	2.85134	7.11019	42
cluster_7.pdb ( medoid)	12.2014	8.44167	24.3065	103
cluster_8.pdb ( medoid)	8.39185	13.3463	34.3888	112
cluster_9.pdb ( medoid)	4.38227	9.81227	21.1372	43
cluster_10.pdb ( medoid)	2.71227	12.1669	27.2574	33