CABS-dock: LHO_Neg_EB

Project name: LHO_Neg_EB_A29

Status: done

submitted: 2025-11-26 05:47:09, status changed: 2025-11-26 07:37:54

Project settings

Protein sequence(s)

MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE input pdb

Peptide sequence

LAAAVAPLLRPLKKRALLAV

Simulation mc cycles

Peptide secondary structure psipred

CHHHHHHHHHHHHHHHHHCC

Unlikely to bind regions

110:A - 80:A

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.3514	7.78754	31.8137	213
cluster_2.pdb ( medoid)	23.456	5.45703	24.4682	128
cluster_3.pdb ( medoid)	18.8067	6.3807	30.5211	120
cluster_4.pdb ( medoid)	18.3436	6.86888	30.089	126
cluster_5.pdb ( medoid)	13.3353	7.04897	27.4905	94
cluster_6.pdb ( medoid)	12.3478	10.2043	35.7337	126
cluster_7.pdb ( medoid)	10.4016	5.47995	18.3415	57
cluster_8.pdb ( medoid)	4.45004	5.39321	11.549	24
cluster_9.pdb ( medoid)	4.33222	20.7746	40.1728	90
cluster_10.pdb ( medoid)	1.62141	13.5684	27.1277	22