Project name: acibam_04_v7_03_p2asn_shuffle_control

Status: job pending waiting for computational server response

submitted: 2026-08-19 22:04:12, status changed: 2026-08-19 22:04:12
Project settings
Protein sequence(s) YVDKSAPEAQLRNNKYLSSAFCQGTWITPINPETKALDADKATSVVTADYGHYNPAGDSVLEGNVVIDQEGRTVRADKVTIDKTQTFAHAQGRVQLAQGGLLSQSDEIDYNLKTQTGNLDNSFYISEQQ input pdb
Peptide sequence PSAPQYNNWQDKE
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCCCC
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
 
Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Laboratory of Computational Biology, 2020