Project name: 5d0120ab5ee39f2

Status: done

submitted: 2026-06-02 11:11:33, status changed: 2026-06-02 17:42:10

Project settings
Protein sequence(s) DHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCIWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFN input pdb
Peptide sequence NVKEDKFKWNLTTRSHH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.9688 4.09251 21.0285 94
cluster_2.pdb ( medoid) 22.0053 10.8156 48.1067 238
cluster_3.pdb ( medoid) 11.517 13.111 28.7907 151
cluster_4.pdb ( medoid) 11.3233 10.3327 39.9692 117
cluster_5.pdb ( medoid) 9.21064 8.68561 22.5315 80
cluster_6.pdb ( medoid) 6.65007 7.6691 21.5058 51
cluster_7.pdb ( medoid) 6.58377 13.67 38.3134 90
cluster_8.pdb ( medoid) 5.90313 10.5029 22.4943 62
cluster_9.pdb ( medoid) 5.20318 13.6455 32.8782 71
cluster_10.pdb ( medoid) 3.39996 13.5296 35.8154 46