Project name: 2jni

Status: done

submitted: 2025-12-12 15:59:59, status changed: 2025-12-12 19:37:10

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence RWCVYAYVRIRGVLVRYRRCW
Simulation mc cycles50
Peptide secondary structure psipred CEEEEEEEEEEEEEEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.8289 6.61297 26.9732 270
cluster_2.pdb ( medoid) 23.7036 4.80939 26.4587 114
cluster_3.pdb ( medoid) 14.2566 6.80385 30.3336 97
cluster_4.pdb ( medoid) 10.6972 7.47862 19.2944 80
cluster_5.pdb ( medoid) 10.0887 9.51563 24.6101 96
cluster_6.pdb ( medoid) 8.46377 11.3425 27.6012 96
cluster_7.pdb ( medoid) 6.53724 13.0024 24.6081 85
cluster_8.pdb ( medoid) 5.7694 14.9062 26.9268 86
cluster_9.pdb ( medoid) 4.41738 10.187 28.265 45
cluster_10.pdb ( medoid) 2.135 14.5199 29.9027 31