Project name: 5d0f575e1551b7f

Status: done

submitted: 2026-07-29 04:56:13, status changed: 2026-07-29 06:42:07

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQLFGSGNY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.8179 5.25768 25.141 141
cluster_2.pdb ( medoid) 24.4237 6.01875 26.5799 147
cluster_3.pdb ( medoid) 16.2923 8.59299 18.81 140
cluster_4.pdb ( medoid) 12.0321 12.3005 36.3672 148
cluster_5.pdb ( medoid) 8.82204 9.63496 26.703 85
cluster_6.pdb ( medoid) 6.96409 13.9286 32.4348 97
cluster_7.pdb ( medoid) 5.49118 13.4761 29.1318 74
cluster_8.pdb ( medoid) 5.43025 10.4968 23.7212 57
cluster_9.pdb ( medoid) 4.03271 14.6304 36.7266 59
cluster_10.pdb ( medoid) 3.79313 13.709 26.3736 52