CABS-dock: 5d0f575e1551b7f

Project name: 5d0f575e1551b7f

Status: done

submitted: 2026-07-29 04:56:13, status changed: 2026-07-29 06:42:07

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGSGNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.8179	5.25768	25.141	141
cluster_2.pdb ( medoid)	24.4237	6.01875	26.5799	147
cluster_3.pdb ( medoid)	16.2923	8.59299	18.81	140
cluster_4.pdb ( medoid)	12.0321	12.3005	36.3672	148
cluster_5.pdb ( medoid)	8.82204	9.63496	26.703	85
cluster_6.pdb ( medoid)	6.96409	13.9286	32.4348	97
cluster_7.pdb ( medoid)	5.49118	13.4761	29.1318	74
cluster_8.pdb ( medoid)	5.43025	10.4968	23.7212	57
cluster_9.pdb ( medoid)	4.03271	14.6304	36.7266	59
cluster_10.pdb ( medoid)	3.79313	13.709	26.3736	52