CABS-dock: TREM2

Project name: TREM2_0

Status: done

submitted: 2026-04-29 12:44:48, status changed: 2026-04-29 14:50:32

Project settings

Protein sequence(s)	TTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVL input pdb
Peptide sequence	LRVRLASHLRKLRKRLL
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.7528	6.10031	27.1666	151
cluster_2.pdb ( medoid)	24.3956	5.61576	23.4574	137
cluster_3.pdb ( medoid)	19.7628	5.3636	12.9153	106
cluster_4.pdb ( medoid)	18.5157	7.02107	22.919	130
cluster_5.pdb ( medoid)	9.45623	12.69	30.7501	120
cluster_6.pdb ( medoid)	8.12418	11.4473	26.8163	93
cluster_7.pdb ( medoid)	5.81775	13.4073	28.4367	78
cluster_8.pdb ( medoid)	5.19144	13.2911	29.52	69
cluster_9.pdb ( medoid)	4.57991	16.5942	36.0382	76
cluster_10.pdb ( medoid)	3.8784	10.3135	23.0311	40