Project name: TREM2_0

Status: done

submitted: 2026-04-29 12:44:48, status changed: 2026-04-29 14:50:32

Project settings
Protein sequence(s) TTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVL input pdb
Peptide sequence LRVRLASHLRKLRKRLL
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.7528 6.10031 27.1666 151
cluster_2.pdb ( medoid) 24.3956 5.61576 23.4574 137
cluster_3.pdb ( medoid) 19.7628 5.3636 12.9153 106
cluster_4.pdb ( medoid) 18.5157 7.02107 22.919 130
cluster_5.pdb ( medoid) 9.45623 12.69 30.7501 120
cluster_6.pdb ( medoid) 8.12418 11.4473 26.8163 93
cluster_7.pdb ( medoid) 5.81775 13.4073 28.4367 78
cluster_8.pdb ( medoid) 5.19144 13.2911 29.52 69
cluster_9.pdb ( medoid) 4.57991 16.5942 36.0382 76
cluster_10.pdb ( medoid) 3.8784 10.3135 23.0311 40