CABS-dock: 5e16e7746b14b43

Project name: 5e16e7746b14b43

Status: done

submitted: 2026-04-01 08:45:57, status changed: 2026-04-01 12:43:21

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAKRLVQVFGNPTYRLHMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	NPVTGRPLVNIYNCSGVQVGDNNYLTMQQT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCEEEEECCCCCEECCCCEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	16.6322	7.8763	29.0709	131
cluster_2.pdb ( medoid)	13.0961	12.8283	35.5492	168
cluster_3.pdb ( medoid)	10.6765	17.4215	39.3734	186
cluster_4.pdb ( medoid)	10.4913	10.8662	30.3468	114
cluster_5.pdb ( medoid)	6.10756	12.4436	33.5016	76
cluster_6.pdb ( medoid)	5.1573	10.4706	33.3524	54
cluster_7.pdb ( medoid)	3.64403	24.1491	45.9059	88
cluster_8.pdb ( medoid)	3.32806	22.5357	42.8694	75
cluster_9.pdb ( medoid)	3.06243	21.225	45.6757	65
cluster_10.pdb ( medoid)	2.08604	20.6132	39.9763	43