CABS-dock: 5e42ec20394390a

Project name: 5e42ec20394390a

Status: done

submitted: 2026-03-18 05:37:18, status changed: 2026-03-18 13:55:02

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRRVQLFGDNAYRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.2919	4.39691	22.294	120
cluster_2.pdb ( medoid)	23.7113	4.93435	26.4004	117
cluster_3.pdb ( medoid)	14.0971	9.78923	27.3438	138
cluster_4.pdb ( medoid)	9.23279	11.9141	34.3211	110
cluster_5.pdb ( medoid)	7.35485	12.6447	29.8828	93
cluster_6.pdb ( medoid)	6.51143	16.8934	43.1309	110
cluster_7.pdb ( medoid)	6.03065	13.9288	28.1989	84
cluster_8.pdb ( medoid)	5.88885	12.0567	25.302	71
cluster_9.pdb ( medoid)	5.79707	13.6276	30.2414	79
cluster_10.pdb ( medoid)	4.64888	16.7782	43.956	78