Project name: 5e9af07f6da6817

Status: done

submitted: 2026-04-01 14:46:49, status changed: 2026-04-01 15:30:32

Project settings
Protein sequence(s) MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence NESRYVNLAKHR
Simulation mc cycles5
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.2243 3.69555 34.7896 108
cluster_2.pdb ( medoid) 20.5766 7.24124 14.342 149
cluster_3.pdb ( medoid) 18.5603 5.38784 10.9471 100
cluster_4.pdb ( medoid) 16.2581 8.42659 35.2108 137
cluster_5.pdb ( medoid) 14.8068 6.61858 23.3955 98
cluster_6.pdb ( medoid) 11.343 9.25678 45.5946 105
cluster_7.pdb ( medoid) 5.68182 8.44799 33.9903 48
cluster_8.pdb ( medoid) 4.27297 16.6161 45.9586 71
cluster_9.pdb ( medoid) 2.25045 18.2186 32.6451 41
cluster_10.pdb ( medoid) 1.99396 15.0454 44.3152 30