Project name: 5fcb36f51565143

Status: done

submitted: 2026-04-14 06:26:42, status changed: 2026-04-14 15:02:17

Project settings
Protein sequence(s) TDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEGYTLTWDNGLVLYSN input pdb
Peptide sequence DALEIYVDDEK
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.2211 5.74158 30.9103 185
cluster_2.pdb ( medoid) 31.8274 3.48756 9.89489 111
cluster_3.pdb ( medoid) 29.4145 4.3176 15.2611 127
cluster_4.pdb ( medoid) 25.5626 4.81172 17.5681 123
cluster_5.pdb ( medoid) 14.2174 9.4251 33.5449 134
cluster_6.pdb ( medoid) 14.2089 8.1639 36.2273 116
cluster_7.pdb ( medoid) 7.21635 10.3931 33.8496 75
cluster_8.pdb ( medoid) 6.1695 9.88735 22.1277 61
cluster_9.pdb ( medoid) 4.36037 8.02683 18.8887 35
cluster_10.pdb ( medoid) 2.74605 12.0173 23.0345 33