Project name: 60b312903aa7b57

Status: done

submitted: 2024-07-12 03:02:29, status changed: 2024-07-12 04:47:50

Project settings
Protein sequence(s) FMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKP input pdb
Peptide sequence KSADTLWGIQK
Simulation mc cycles50
Peptide secondary structure psipred CCHHCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.9937 4.09455 16.6883 131
cluster_2.pdb ( medoid) 30.6154 4.08291 11.4454 125
cluster_3.pdb ( medoid) 30.2954 5.84246 28.8282 177
cluster_4.pdb ( medoid) 20.8613 5.75228 20.6195 120
cluster_5.pdb ( medoid) 14.3159 7.19478 23.9806 103
cluster_6.pdb ( medoid) 9.57413 13.996 42.0549 134
cluster_7.pdb ( medoid) 8.45801 6.62094 21.5883 56
cluster_8.pdb ( medoid) 5.61527 13.5345 36.7467 76
cluster_9.pdb ( medoid) 3.65511 15.0474 34.6603 55
cluster_10.pdb ( medoid) 2.07952 11.0602 23.9275 23