CABS-dock: 6149011bb188b57

Project name: 6149011bb188b57

Status: done

submitted: 2026-01-16 09:59:50, status changed: 2026-01-17 00:05:21

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RVIVQVGFSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	44.8926	2.36119	26.9671	106
cluster_2.pdb ( medoid)	24.0663	4.57071	25.8529	110
cluster_3.pdb ( medoid)	20.193	7.72546	19.9417	156
cluster_4.pdb ( medoid)	18.2743	7.16855	41.3899	131
cluster_5.pdb ( medoid)	7.04286	18.0324	49.1466	127
cluster_6.pdb ( medoid)	6.03951	21.5249	65.1694	130
cluster_7.pdb ( medoid)	4.4235	17.181	36.7646	76
cluster_8.pdb ( medoid)	3.27017	18.0419	47.88	59
cluster_9.pdb ( medoid)	2.31921	25.4396	51.2519	59
cluster_10.pdb ( medoid)	2.2599	20.3549	43.6247	46