CABS-dock: 6149573118b7204

Project name: 6149573118b7204

Status: done

submitted: 2026-03-09 04:41:40, status changed: 2026-03-09 07:10:31

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGDSNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.4974	7.22044	32.2828	148
cluster_2.pdb ( medoid)	18.7391	7.2042	35.005	135
cluster_3.pdb ( medoid)	12.6366	11.2372	28.9689	142
cluster_4.pdb ( medoid)	10.2145	7.04881	17.9165	72
cluster_5.pdb ( medoid)	9.68814	7.84465	21.4119	76
cluster_6.pdb ( medoid)	9.13671	10.6165	22.0578	97
cluster_7.pdb ( medoid)	8.5746	10.7294	26.4586	92
cluster_8.pdb ( medoid)	7.74912	13.1628	36.3132	102
cluster_9.pdb ( medoid)	7.09129	12.2686	39.5815	87
cluster_10.pdb ( medoid)	3.93692	12.4463	27.8774	49