Project name: 3FV7 200

Status: done

submitted: 2025-11-12 18:59:50, status changed: 2025-11-13 21:52:58

Project settings
Protein sequence(s) HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII input pdb
Peptide sequence KDSMEEY
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 86.0775 2.14923 5.17869 185
cluster_2.pdb ( medoid) 37.9669 2.42317 12.1232 92
cluster_3.pdb ( medoid) 24.472 7.80483 41.5424 191
cluster_4.pdb ( medoid) 18.7638 3.51741 9.05403 66
cluster_5.pdb ( medoid) 15.2268 4.79416 14.374 73
cluster_6.pdb ( medoid) 14.0133 7.42154 41.5613 104
cluster_7.pdb ( medoid) 13.1122 8.54167 23.4247 112
cluster_8.pdb ( medoid) 12.4008 6.28992 13.0512 78
cluster_9.pdb ( medoid) 4.35731 15.8355 46.3982 69
cluster_10.pdb ( medoid) 2.41261 12.4347 35.3913 30