Project name: 621ea3aab7dfae

Status: done

submitted: 2026-03-12 12:43:52, status changed: 2026-03-12 19:46:56

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RVQLFGSNR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.6723 4.90801 22.3395 126
cluster_2.pdb ( medoid) 22.358 5.8592 24.2374 131
cluster_3.pdb ( medoid) 15.5067 9.7377 32.7958 151
cluster_4.pdb ( medoid) 10.3532 14.102 40.2072 146
cluster_5.pdb ( medoid) 9.18134 14.7037 46.4693 135
cluster_6.pdb ( medoid) 5.78715 9.84941 34.5084 57
cluster_7.pdb ( medoid) 5.36298 11.9337 35.216 64
cluster_8.pdb ( medoid) 4.76514 15.9492 36.8617 76
cluster_9.pdb ( medoid) 3.44966 15.074 37.3218 52
cluster_10.pdb ( medoid) 2.956 20.9743 51.8834 62