CABS-dock: 62536ef217b4237

Project name: 62536ef217b4237

Status: done

submitted: 2024-07-12 09:46:23, status changed: 2024-07-12 11:06:05

Project settings

Protein sequence(s)	APYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPEL input pdb
Peptide sequence	TWSGGM
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	58.742	3.0983	13.8118	182
cluster_2.pdb ( medoid)	38.7944	4.63984	24.2064	180
cluster_3.pdb ( medoid)	32.8657	4.99001	16.1065	164
cluster_4.pdb ( medoid)	15.9857	5.37979	14.8394	86
cluster_5.pdb ( medoid)	11.5942	5.95127	13.2428	69
cluster_6.pdb ( medoid)	10.4761	8.49554	20.4311	89
cluster_7.pdb ( medoid)	9.6318	5.9179	19.7151	57
cluster_8.pdb ( medoid)	9.13702	8.09892	17.8777	74
cluster_9.pdb ( medoid)	6.92428	8.66517	21.9799	60
cluster_10.pdb ( medoid)	5.44502	7.1625	15.1908	39