Project name: MM19_1POZ V178-S

Status: done

submitted: 2025-05-30 08:10:07, status changed: 2025-05-30 11:55:59

Project settings
Protein sequence(s) AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV input pdb
Peptide sequence WDSRGKDSYETSQL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCC
Unlikely to bind regions
105:A - 105:A 101:A - 101:A 100:A - 100:A 79:A - 79:A 78:A - 78:A
68:A - 68:A 42:A - 42:A 41:A - 41:A 38:A - 38:A
Contact information
178:A 12:PEP 2.81 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 60.3007 3.48255 10.2902 210
cluster_2.pdb ( medoid) 33.4294 3.14095 9.38892 105
cluster_3.pdb ( medoid) 30.2201 3.40833 10.1354 103
cluster_4.pdb ( medoid) 21.3705 5.38126 10.6374 115
cluster_5.pdb ( medoid) 20.8662 5.31961 11.3159 111
cluster_6.pdb ( medoid) 20.7875 3.75226 8.41482 78
cluster_7.pdb ( medoid) 20.3124 6.8431 16.1947 139
cluster_8.pdb ( medoid) 19.5927 4.69561 9.62338 92
cluster_9.pdb ( medoid) 5.32463 5.63419 8.72577 30
cluster_10.pdb ( medoid) 2.86055 5.94291 10.4882 17