CABS-dock: 62abd457589b425

Project name: 62abd457589b425

Status: done

submitted: 2026-07-22 09:13:46, status changed: 2026-07-22 11:15:24

Project settings

Protein sequence(s)	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence	IGASWPDHATT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.9637	5.29967	25.7075	127
cluster_2.pdb ( medoid)	21.8267	5.81856	18.5135	127
cluster_3.pdb ( medoid)	12.3476	8.09876	18.0828	100
cluster_4.pdb ( medoid)	10.5767	12.0075	24.748	127
cluster_5.pdb ( medoid)	10.2957	12.0438	27.2971	124
cluster_6.pdb ( medoid)	8.46702	12.2829	25.3179	104
cluster_7.pdb ( medoid)	7.89147	14.446	28.679	114
cluster_8.pdb ( medoid)	7.69524	8.83663	19.9169	68
cluster_9.pdb ( medoid)	5.13734	9.92731	21.2024	51
cluster_10.pdb ( medoid)	4.37339	13.262	28.4719	58