CABS-dock: 2muh

Project name: 2muh

Status: done

submitted: 2025-12-12 16:07:36, status changed: 2025-12-12 19:24:25

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	RGGRLCYCRRRFCVCV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEEEECCEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.1192	3.51814	20.1388	113
cluster_2.pdb ( medoid)	23.0106	5.77995	23.3073	133
cluster_3.pdb ( medoid)	17.5942	9.09391	33.441	160
cluster_4.pdb ( medoid)	14.9581	7.95557	23.1129	119
cluster_5.pdb ( medoid)	10.3605	13.9955	37.0526	145
cluster_6.pdb ( medoid)	9.91639	11.7986	29.6917	117
cluster_7.pdb ( medoid)	5.95155	10.2494	25.0057	61
cluster_8.pdb ( medoid)	4.88478	9.00758	24.9657	44
cluster_9.pdb ( medoid)	4.39405	11.1514	22.1424	49
cluster_10.pdb ( medoid)	4.17742	14.1235	28.8988	59