Project name: 62dadb5bb51b3a0

Status: done

submitted: 2026-03-13 10:27:55, status changed: 2026-03-13 13:14:09

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence RRMKWKKVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 17.1206 9.6375 35.1639 165
cluster_2.pdb ( medoid) 16.9777 10.4254 44.6867 177
cluster_3.pdb ( medoid) 15.11 9.53012 32.399 144
cluster_4.pdb ( medoid) 15.0637 9.09472 31.2378 137
cluster_5.pdb ( medoid) 11.3703 6.85999 31.5268 78
cluster_6.pdb ( medoid) 9.78723 5.00653 25.1371 49
cluster_7.pdb ( medoid) 8.66694 3.92295 12.03 34
cluster_8.pdb ( medoid) 5.18397 16.9754 45.9162 88
cluster_9.pdb ( medoid) 4.04847 17.0435 40.4354 69
cluster_10.pdb ( medoid) 3.66062 16.1175 46.0726 59