Project name: 63596086064365d

Status: done

submitted: 2026-02-19 23:42:53, status changed: 2026-02-20 04:39:06

Project settings
Protein sequence(s) VLLLDVTPLSLGIETMMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH input pdb
Peptide sequence PPQGRPYFKPTPFPGARGGK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.4945 3.71493 20.6852 117
cluster_2.pdb ( medoid) 18.2568 8.32564 39.3858 152
cluster_3.pdb ( medoid) 18.1008 5.41412 19.127 98
cluster_4.pdb ( medoid) 16.2025 7.1594 38.47 116
cluster_5.pdb ( medoid) 12.9322 5.56751 13.1294 72
cluster_6.pdb ( medoid) 10.1905 14.5233 44.6215 148
cluster_7.pdb ( medoid) 7.13064 14.4447 53.504 103
cluster_8.pdb ( medoid) 7.09171 12.2678 47.3975 87
cluster_9.pdb ( medoid) 6.44026 9.00585 40.4967 58
cluster_10.pdb ( medoid) 2.08004 23.5573 49.2061 49