CABS-dock: NOTCH+HYBRID3

Project name: NOTCH+HYBRID3

Status: done

submitted: 2025-06-07 18:50:46, status changed: 2025-06-07 20:34:02

Project settings

Protein sequence(s)	QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQ input pdb
Peptide sequence	FLHVAKKKHKKAAGK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCHHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.5282	5.44027	15.177	128
cluster_2.pdb ( medoid)	16.8631	6.5231	18.0089	110
cluster_3.pdb ( medoid)	15.3269	5.41532	15.1143	83
cluster_4.pdb ( medoid)	14.1302	10.5448	24.8691	149
cluster_5.pdb ( medoid)	12.8678	6.8388	15.3644	88
cluster_6.pdb ( medoid)	12.5692	10.0245	23.3811	126
cluster_7.pdb ( medoid)	9.959	7.33006	21.7225	73
cluster_8.pdb ( medoid)	9.85408	10.757	22.9596	106
cluster_9.pdb ( medoid)	9.73752	9.44799	22.2661	92
cluster_10.pdb ( medoid)	5.6021	8.0327	18.3206	45