CABS-dock: 64bc832a466a74c

Project name: 64bc832a466a74c

Status: done

submitted: 2026-01-14 13:56:23, status changed: 2026-01-15 02:05:10

Project settings

Protein sequence(s)	QIIPSNTTSPPTNSTSPPTNATAPAPSPTNTITKAANITKPGCPKQCGNVTVPYPFGIGSGCALDPMFEIDCNVTTPFIGNIQIYDISDAEMRISNFINTKCYSQTGVLIQDIPSWITLGTKSPYTFSTLNRFIVVGCDDGAIVSGNNFANGCPSLCTSTNDIVKGKCMGFGCCQITIPKGLKFFNTTMVTTRNHSLIWSFNPCGHSFLGEASRFEFQGIEDLSDVNFANKIRNNVPIVLDWAIGNLSCVEARKSNDYACLNNSQCVDSDTSLGGYRCSCNSGYIGNPYIGSGCQDIDECADPNTNSCEKICTNIPGSYNCSCPEGYTGDGRKNGRGCIAPNSNSEFPWIK input pdb
Peptide sequence	GNGDQGENQKPMFELAEGATLKNVNLGENE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCCCEEECCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.1042	2.55727	4.70118	100
cluster_2.pdb ( medoid)	16.0219	11.2346	64.6947	180
cluster_3.pdb ( medoid)	13.6548	14.061	40.4055	192
cluster_4.pdb ( medoid)	6.39577	11.5701	39.3052	74
cluster_5.pdb ( medoid)	4.53467	9.48251	38.0213	43
cluster_6.pdb ( medoid)	3.70051	11.8903	29.7011	44
cluster_7.pdb ( medoid)	3.60788	14.9672	35.8107	54
cluster_8.pdb ( medoid)	3.60125	12.218	36.5279	44
cluster_9.pdb ( medoid)	2.57667	11.2548	20.6518	29
cluster_10.pdb ( medoid)	1.66243	25.2643	63.128	42