Project name: 64ea047de4c923a

Status: done

submitted: 2025-12-31 15:54:29, status changed: 2025-12-31 18:46:01

Project settings
Protein sequence(s) MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence LPPTDESIKYTIYNSTGIQIGAYNYMEIGG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEEEECCCCEEECCCCEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.2498 3.68144 19.6791 104
cluster_2.pdb ( medoid) 21.8951 5.29799 29.6837 116
cluster_3.pdb ( medoid) 15.0891 7.29005 26.7313 110
cluster_4.pdb ( medoid) 11.4162 10.161 26.1993 116
cluster_5.pdb ( medoid) 9.53309 12.0632 28.7043 115
cluster_6.pdb ( medoid) 8.53282 12.7742 29.6465 109
cluster_7.pdb ( medoid) 7.08622 15.6642 34.9544 111
cluster_8.pdb ( medoid) 6.35157 16.2165 30.1385 103
cluster_9.pdb ( medoid) 5.97976 13.3785 31.9436 80
cluster_10.pdb ( medoid) 2.71711 13.2494 29.3452 36