Project name: 65db052fcddefef

Status: done

submitted: 2026-01-13 17:36:02, status changed: 2026-01-13 18:58:44

Project settings
Protein sequence(s) ETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVETFSDLWKLLPEN input pdb
Peptide sequence MPLLKCWDCFCE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 48.5756 1.13226 8.99534 55
cluster_2.pdb ( medoid) 19.2404 8.31585 27.321 160
cluster_3.pdb ( medoid) 17.4279 15.3777 41.4016 268
cluster_4.pdb ( medoid) 13.2503 11.7733 37.8187 156
cluster_5.pdb ( medoid) 11.7271 4.43417 20.6968 52
cluster_6.pdb ( medoid) 10.2857 9.72223 38.0435 100
cluster_7.pdb ( medoid) 6.1968 10.812 27.2597 67
cluster_8.pdb ( medoid) 5.64994 12.9205 42.0125 73
cluster_9.pdb ( medoid) 4.26683 7.73408 19.5872 33
cluster_10.pdb ( medoid) 2.16642 16.6173 32.0884 36