Project name: pep6

Status: done

submitted: 2026-02-26 12:52:44, status changed: 2026-02-27 05:15:09

Project settings
Protein sequence(s) SFELTQPPSVSVSPGQTASITCSGDKLGDIYASWYQQKPGQSPVVVIFQDNKRPSGVPERFSGSNSGNTATLTISGTQALDEADYYCQAWDTSTSVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAIHWVRQAPGKGLEWVSGLSGGGGDTDYADSVKGRLTISRDNSKKTLFLEMNNLRPEDTAIYYCAKLTGYGSTPGSYMDVWGKGTTVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC input pdb
Peptide sequence SFGDGFADF
Simulation mc cycles50
Peptide secondary structure CCCCHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.2587 5.09688 34.8916 195
cluster_2.pdb ( medoid) 22.853 4.9009 32.6031 112
cluster_3.pdb ( medoid) 19.4301 4.73491 16.0953 92
cluster_4.pdb ( medoid) 18.9009 5.60819 18.2444 106
cluster_5.pdb ( medoid) 17.5126 5.99567 17.6247 105
cluster_6.pdb ( medoid) 15.5422 6.24106 32.5644 97
cluster_7.pdb ( medoid) 11.639 8.59179 36.5296 100
cluster_8.pdb ( medoid) 11.5279 6.76622 16.0794 78
cluster_9.pdb ( medoid) 7.94398 11.9587 35.908 95
cluster_10.pdb ( medoid) 1.98553 10.0729 35.9916 20