CABS-dock: pep6

Project name: pep6

Status: done

submitted: 2026-02-26 12:52:44, status changed: 2026-02-27 05:15:09

Project settings

Protein sequence(s)	SFELTQPPSVSVSPGQTASITCSGDKLGDIYASWYQQKPGQSPVVVIFQDNKRPSGVPERFSGSNSGNTATLTISGTQALDEADYYCQAWDTSTSVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAIHWVRQAPGKGLEWVSGLSGGGGDTDYADSVKGRLTISRDNSKKTLFLEMNNLRPEDTAIYYCAKLTGYGSTPGSYMDVWGKGTTVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC input pdb
Peptide sequence	SFGDGFADF
Simulation mc cycles	50
Peptide secondary structure	CCCCHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	38.2587	5.09688	34.8916	195
cluster_2.pdb ( medoid)	22.853	4.9009	32.6031	112
cluster_3.pdb ( medoid)	19.4301	4.73491	16.0953	92
cluster_4.pdb ( medoid)	18.9009	5.60819	18.2444	106
cluster_5.pdb ( medoid)	17.5126	5.99567	17.6247	105
cluster_6.pdb ( medoid)	15.5422	6.24106	32.5644	97
cluster_7.pdb ( medoid)	11.639	8.59179	36.5296	100
cluster_8.pdb ( medoid)	11.5279	6.76622	16.0794	78
cluster_9.pdb ( medoid)	7.94398	11.9587	35.908	95
cluster_10.pdb ( medoid)	1.98553	10.0729	35.9916	20