Project name: N-P08670-1

Status: done

submitted: 2025-10-10 03:21:06, status changed: 2025-10-11 09:15:04

Project settings
Protein sequence(s) ASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGGASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKT input pdb
Peptide sequence VPGVRLLQ
Simulation mc cycles150
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 52.6743 2.99956 25.3277 158
cluster_2.pdb ( medoid) 38.8281 2.88451 29.1281 112
cluster_3.pdb ( medoid) 25.7631 3.14403 8.60932 81
cluster_4.pdb ( medoid) 21.4654 4.14621 9.57744 89
cluster_5.pdb ( medoid) 19.1286 2.97983 12.9862 57
cluster_6.pdb ( medoid) 16.7458 11.4059 46.9413 191
cluster_7.pdb ( medoid) 13.9452 5.01963 22.9467 70
cluster_8.pdb ( medoid) 13.6893 10.1539 44.0702 139
cluster_9.pdb ( medoid) 8.63176 9.96321 29.8074 86
cluster_10.pdb ( medoid) 3.92234 4.33415 7.26039 17