CABS-dock: 66df06fb607008c

Project name: 66df06fb607008c

Status: done

submitted: 2026-04-02 08:12:24, status changed: 2026-04-02 08:45:13

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	ECMHRLMRLQIS
Simulation mc cycles	5
Peptide secondary structure psipred	CHHHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.806	5.57532	19.8251	116
cluster_2.pdb ( medoid)	14.8334	7.48309	23.827	111
cluster_3.pdb ( medoid)	13.3098	10.5186	21.6068	140
cluster_4.pdb ( medoid)	11.2118	7.84889	31.8689	88
cluster_5.pdb ( medoid)	9.05076	9.72294	21.758	88
cluster_6.pdb ( medoid)	7.44988	10.2015	29.117	76
cluster_7.pdb ( medoid)	6.27965	15.4467	38.3394	97
cluster_8.pdb ( medoid)	6.09336	9.68268	17.4858	59
cluster_9.pdb ( medoid)	5.17246	10.6332	27.7992	55
cluster_10.pdb ( medoid)	5.01933	14.743	46.6606	74