Project name: 66df06fb607008c

Status: done

submitted: 2026-04-02 08:12:24, status changed: 2026-04-02 08:45:13

Project settings
Protein sequence(s) MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence ECMHRLMRLQIS
Simulation mc cycles5
Peptide secondary structure psipred CHHHHHHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.806 5.57532 19.8251 116
cluster_2.pdb ( medoid) 14.8334 7.48309 23.827 111
cluster_3.pdb ( medoid) 13.3098 10.5186 21.6068 140
cluster_4.pdb ( medoid) 11.2118 7.84889 31.8689 88
cluster_5.pdb ( medoid) 9.05076 9.72294 21.758 88
cluster_6.pdb ( medoid) 7.44988 10.2015 29.117 76
cluster_7.pdb ( medoid) 6.27965 15.4467 38.3394 97
cluster_8.pdb ( medoid) 6.09336 9.68268 17.4858 59
cluster_9.pdb ( medoid) 5.17246 10.6332 27.7992 55
cluster_10.pdb ( medoid) 5.01933 14.743 46.6606 74