Project name: 66ef9386c3e2a09

Status: done

submitted: 2026-04-10 07:46:39, status changed: 2026-04-10 11:15:34

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRRVQPYGSNDARRH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 17.7701 6.80919 23.7942 121
cluster_2.pdb ( medoid) 16.0705 4.85361 19.2098 78
cluster_3.pdb ( medoid) 15.4149 8.30363 26.7817 128
cluster_4.pdb ( medoid) 12.2713 4.31901 16.259 53
cluster_5.pdb ( medoid) 11.8142 10.0727 33.4559 119
cluster_6.pdb ( medoid) 9.2736 14.6653 28.0704 136
cluster_7.pdb ( medoid) 8.5921 12.6861 25.91 109
cluster_8.pdb ( medoid) 6.00249 16.8264 33.2624 101
cluster_9.pdb ( medoid) 5.84596 13.0004 25.2311 76
cluster_10.pdb ( medoid) 5.70912 13.8375 33.011 79